DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and tmprss15

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_001919639.2 Gene:tmprss15 / 100148042 ZFINID:ZDB-GENE-091204-83 Length:990 Species:Danio rerio


Alignment Length:251 Identity:83/251 - (33%)
Similarity:123/251 - (49%) Gaps:24/251 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAG 88
            ||.:::||:|||.:.....:|..||||....||||.|:|....::||||||        |.....
Zfish   740 TDGKKEGRVVGGQDAQRGAWPWMVSLQWLGGHACGATLIDREWLITAAHCV--------YGRNVQ 796

  Fly    89 SSDW-------------TKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISL 140
            .|:|             ........|.::|.|..::..|: .:|.|::.|:.|:.|:..::||.|
Zfish   797 LSNWAAVLGLHAQFETINPNKQVFSVDQVIMHKHYNKRTK-ESDFALMHLKTPVSYTDYVQPICL 860

  Fly   141 ATSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQ 205
            ...........:.|::|||..|.|.::.:. |:..||.|....|| :.:......|..|.|||..
Zfish   861 PDPGAHFEEGRKCFIAGWGLLSESGLKADV-LQQAVVPLLSNTQC-QEWLPEYNFTERMMCAGYA 923

  Fly   206 AGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQ 261
            .||.|:|||||||||:...:|...|.|..|:|.||.....||.|.:||.:.||:|:
Zfish   924 EGGVDTCQGDSGGPLMCEEEGHWVLVGATSFGIGCGRPQRPGAYARVSQFVDWVAE 979

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 78/240 (33%)
Tryp_SPc 32..262 CDD:238113 79/243 (33%)
tmprss15XP_001919639.2 SEA 19..>89 CDD:279699
LDLa 142..175 CDD:238060
CUB 183..288 CDD:238001
MAM 302..457 CDD:279023
MAM 302..457 CDD:99706
CUB 477..586 CDD:238001
LDLa 596..630 CDD:238060
SRCR_2 653..728 CDD:295335
Tryp_SPc 747..977 CDD:214473 78/240 (33%)
Tryp_SPc 748..980 CDD:238113 79/243 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3952
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.