DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and zgc:165423

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:252 Identity:88/252 - (34%)
Similarity:128/252 - (50%) Gaps:13/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKP 80
            |..|..|:       :||||.......:|.|.||.....|.|||::||...||:||||......|
Zfish    29 CGKAPLNT-------KIVGGTNASAGSWPWQASLHESGSHFCGGSLISDQWILSAAHCFPSNPNP 86

  Fly    81 QYYVIRAG--SSDWTKGGSYIR-VKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLAT 142
            ..|.:..|  |.|........: |.::|.||.:...|. :||:|::.|..|:.:|..|:|:.||.
Zfish    87 SDYTVYLGRQSQDLPNPNEVSKSVSQVIVHPLYQGSTH-DNDMALLHLSSPVTFSNYIQPVCLAA 150

  Fly   143 SKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTV-VHLRDQNQCARNYFGAGTVTNTMFCAGTQA 206
            ...... ...::::|||:.......|..::...| |.:...|.|...|.|..::||.|.|||...
Zfish   151 DGSTFY-NDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLCNCLYGGGSSITNNMMCAGLMQ 214

  Fly   207 GGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTI 263
            ||:||||||||||:|..........|:||:|.|||:..:||:|.:||.|.:||:|.:
Zfish   215 GGKDSCQGDSGGPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWISQYV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 82/231 (35%)
Tryp_SPc 32..262 CDD:238113 84/233 (36%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 82/231 (35%)
Tryp_SPc 38..269 CDD:238113 84/232 (36%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.