DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and HSPB3

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_006299.1 Gene:HSPB3 / 8988 HGNCID:5248 Length:150 Species:Homo sapiens


Alignment Length:120 Identity:32/120 - (26%)
Similarity:54/120 - (45%) Gaps:30/120 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYSELKVKVLDESVVL--VEG--- 90
            |||.|.|                ..|....|..:::.|||       |:.|.|.:::  .||   
Human    54 PPVDSAA----------------ETPPREGKSHFQILLDV-------VQFLPEDIIIQTFEGWLL 95

  Fly    91 -KSEQ-QEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQ 143
             |::. ...::.|:.||.|.|::.||:|.|...:::.|..||:|.:.|.:|.|.:
Human    96 IKAQHGTRMDEHGFISRSFTRQYKLPDGVEIKDLSAVLCHDGILVVEVKDPVGTK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 32/120 (27%)
metazoan_ACD 61..138 CDD:107247 24/83 (29%)
HSPB3NP_006299.1 ACD_HspB3_Like 63..145 CDD:107232 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.