DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and AT1G53540

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_175759.1 Gene:AT1G53540 / 841789 AraportID:AT1G53540 Length:157 Species:Arabidopsis thaliana


Alignment Length:141 Identity:37/141 - (26%)
Similarity:65/141 - (46%) Gaps:21/141 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PFHAF-----FHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYSELKVKVLD 82
            ||..|     ....|...||...|.:  ..|:|   .|.|.|    :|..|......|:||:|.|
plant    26 PFEGFLTPSGLANAPAMDVAAFTNAK--VDWRE---TPEAHV----FKADLPGLRKEEVKVEVED 81

  Fly    83 ESVVLVEGKSEQQEAEQGG------YSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPG 141
            .:::.:.|:...:..|:..      .||..|.|||.|||..:.:::.::: .:|||:::||..|.
plant    82 GNILQISGERSNENEEKNDKWHRVERSSGKFTRRFRLPENAKMEEIKASM-ENGVLSVTVPKVPE 145

  Fly   142 VQETLKEREVT 152
            .:..:|..:::
plant   146 KKPEVKSIDIS 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 37/141 (26%)
metazoan_ACD 61..138 CDD:107247 22/82 (27%)
AT1G53540NP_175759.1 IbpA 11..156 CDD:223149 37/139 (27%)
ACD_ScHsp26_like 51..142 CDD:107229 27/100 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100183
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.