DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and AT1G52560

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_175665.1 Gene:AT1G52560 / 841687 AraportID:AT1G52560 Length:232 Species:Arabidopsis thaliana


Alignment Length:166 Identity:32/166 - (19%)
Similarity:69/166 - (41%) Gaps:53/166 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PRNWQQIARWQE-----------QEFAPP--------ATVN----------------------KD 62
            ||...:.:.|:.           .||.||        ||.|                      .|
plant    70 PRRRGRKSLWRNTDDHGYFTPTLNEFFPPTIGNTLIQATENMNRIFDNFNVNPFQLMGQVKEQDD 134

  Fly    63 GYKLTLDVKDYSELKVKV-LDESVVLVEG--KSEQQEA---EQGGYSSR---HFLRRFVLPEGYE 118
            .|||..:|...::..||: :::.::.::|  |:|:::.   |...:||:   ::.....||:..:
plant   135 CYKLRYEVPGLTKEDVKITVNDGILTIKGDHKAEEEKGSPEEDEYWSSKSYGYYNTSLSLPDDAK 199

  Fly   119 ADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIE 154
            .:.:.:.| .:|||.:.:|.....::.:  :|:::|
plant   200 VEDIKAEL-KNGVLNLVIPRTEKPKKNV--QEISVE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 19/85 (22%)
AT1G52560NP_175665.1 IbpA 126..232 CDD:439841 21/108 (19%)

Return to query results.
Submit another query.