DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and AT5G37670

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_198583.1 Gene:AT5G37670 / 833746 AraportID:AT5G37670 Length:137 Species:Arabidopsis thaliana


Alignment Length:145 Identity:38/145 - (26%)
Similarity:64/145 - (44%) Gaps:35/145 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PFHAFFHEPPVWSVALPRNWQQ---IARWQEQEFAPPATVNKDGYKLTLDVKDYSELKVKVLDES 84
            ||..|            :.|.:   :..|.|...:....:|..||       :..::||::.:.:
plant    10 PFRRF------------QEWSRSTALIDWMESNNSHIFKINVPGY-------NKEDIKVQIEEGN 55

  Fly    85 VVLVEG---KSEQQE------AEQGGYS--SRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPN 138
            |:.:.|   |.|::|      ||:..:|  ...||||..|||..:.|:|.:.: .:||||:.||.
plant    56 VLSIRGEGIKEEKKENLVWHVAEREAFSGGGSEFLRRIELPENVKVDQVKAYV-ENGVLTVVVPK 119

  Fly   139 PPGVQETLKEREVTI 153
            ... .::.|.|.|.|
plant   120 DTS-SKSSKVRNVNI 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 38/145 (26%)
metazoan_ACD 61..138 CDD:107247 26/87 (30%)
AT5G37670NP_198583.1 ACD_ScHsp26_like 24..119 CDD:107229 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.