DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and ATHSP22.0

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_192763.1 Gene:ATHSP22.0 / 826616 AraportID:AT4G10250 Length:195 Species:Arabidopsis thaliana


Alignment Length:148 Identity:38/148 - (25%)
Similarity:71/148 - (47%) Gaps:38/148 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SVALPR---NWQQIARWQEQEFAPPATVNKDGYKLTLDV----KDYSELKVKVLDESVVLVEGKS 92
            ||||..   :|::.|               :|:::.||:    ||  |:|::|.:..|:.|.|:.
plant    65 SVALSPARVDWKETA---------------EGHEIMLDIPGLKKD--EVKIEVEENGVLRVSGER 112

  Fly    93 EQQEAEQGGYSSR------HFLRRFVLPEGYEADKVTSTLSSDGVLTISVP--NP-----PGVQE 144
            :::|.::|....|      .|.|:|.||:..:.:.|.:.| .:|||||::.  :|     |.|..
plant   113 KREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKL-ENGVLTINLTKLSPEKVKGPRVVN 176

  Fly   145 TLKEREVTIEQTGEPAKK 162
            ...|.:.|.:.:...:|:
plant   177 IAAEEDQTAKISSSESKE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 37/138 (27%)
metazoan_ACD 61..138 CDD:107247 26/88 (30%)
ATHSP22.0NP_192763.1 IbpA 42..177 CDD:223149 35/129 (27%)
ACD_ScHsp26_like 72..163 CDD:107229 28/108 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100183
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.