DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and Hspb8

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_109629.1 Gene:Hspb8 / 80888 MGIID:2135756 Length:196 Species:Mus musculus


Alignment Length:159 Identity:47/159 - (29%)
Similarity:71/159 - (44%) Gaps:28/159 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RSLPMFWRMAEEMARMPRLSSPFHAFFHEP-PVWSVALPR---NWQQIARWQEQEFAPPAT---- 58
            |..|:..|:.::...|    .||......| |.|  ||||   .|....|.......||||    
Mouse    22 RDSPLSSRLLDDGFGM----DPFPDDLTAPWPEW--ALPRLSSAWPGTLRSGMVPRGPPATARFG 80

  Fly    59 VNKDG----------YKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRF 111
            |..:|          :|:.::|..:  .||.||..| ..|.|.||.|::: ::||..|::|.::.
Mouse    81 VPAEGRSPPPFPGEPWKVCVNVHSFKPEELMVKTKD-GYVEVSGKHEEKQ-QEGGIVSKNFTKKI 143

  Fly   112 VLPEGYEADKVTSTLSSDGVLTISVPNPP 140
            .||...:...|.::||.:|:|.|..|..|
Mouse   144 QLPAEVDPATVFASLSPEGLLIIEAPQVP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 44/144 (31%)
metazoan_ACD 61..138 CDD:107247 25/88 (28%)
Hspb8NP_109629.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 2/5 (40%)
ACD_HspB8_like 80..170 CDD:107235 26/91 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839005
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.