DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hspb8

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001094427.2 Gene:hspb8 / 791580 ZFINID:ZDB-GENE-030131-2480 Length:216 Species:Danio rerio


Alignment Length:153 Identity:39/153 - (25%)
Similarity:74/153 - (48%) Gaps:8/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLSSPFHAFFHEP-PVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDY--SELKVKV 80
            ||.:|:....... |..|::.|:.:..:.....:..:.|.|.:.:.:|:.::|..:  .||.||.
Zfish    58 RLDAPWTGSLRSGFPRASMSSPQGFSSVYTESPRRASAPPTDSDEPWKVCVNVHSFKPEELNVKT 122

  Fly    81 LDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQET 145
            .| ..|.|.||.|::: ::||..:::|.::..:|...:...|.::||.:|||.|.....|...  
Zfish   123 KD-GFVEVSGKHEEKQ-DEGGIVTKNFTKKIQIPLDVDPVTVFASLSPEGVLIIEARQTPPYY-- 183

  Fly   146 LKEREVTIEQTGEPAKKSAEEPN 168
            |...|:..|...||..: .:||:
Zfish   184 LYSNEMPAESMEEPEAR-PQEPS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 34/137 (25%)
metazoan_ACD 61..138 CDD:107247 23/78 (29%)
hspb8NP_001094427.2 ACD_HspB8_like 88..178 CDD:107235 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4974
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.