DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hspb15

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001092202.1 Gene:hspb15 / 555589 ZFINID:ZDB-GENE-080214-5 Length:154 Species:Danio rerio


Alignment Length:81 Identity:26/81 - (32%)
Similarity:44/81 - (54%) Gaps:4/81 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VNKDGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADK 121
            :.:..:|:.|||..:|  |:.||..|..:.:.....|:||..:  ..||.|.|::.||...:..:
Zfish    34 IGEQDWKVCLDVGPFSPEEISVKTRDGYLEITGNHEERQENHR--LISRSFARKYKLPADLDLKQ 96

  Fly   122 VTSTLSSDGVLTISVP 137
            ::|.||.||||::..|
Zfish    97 ISSMLSPDGVLSVEAP 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 26/81 (32%)
metazoan_ACD 61..138 CDD:107247 26/79 (33%)
hspb15NP_001092202.1 metazoan_ACD 35..113 CDD:107247 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.