DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and Hspb7

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_113795.1 Gene:Hspb7 / 50565 RGDID:62021 Length:169 Species:Rattus norvegicus


Alignment Length:157 Identity:42/157 - (26%)
Similarity:65/157 - (41%) Gaps:34/157 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RSLPMFWRMAEEMARMPRLSSPFHAFF--HEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGY 64
            |:||......|:...|  .|..|.:|.  |..|:...|.|.....|           .|:. |.|
  Rat    31 RALPAQDPPMEKALSM--FSEDFGSFMLPHSEPLTFPARPGGQGNI-----------KTLG-DAY 81

  Fly    65 KLTLDVKDYSELKVKVLDESVVL------VEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVT 123
            :.|:|::|:|       .|.:::      :|.::|:..|:  |.....|..:..|||..:...||
  Rat    82 EFTVDMRDFS-------PEDIIVTTSNNHIEVRAEKLAAD--GTVMNTFAHKCQLPEDVDPTSVT 137

  Fly   124 STLSSDGVLTISV---PNPPGVQETLK 147
            |.|..||.|||..   |:...||:|.:
  Rat   138 SALREDGSLTIRARRHPHTEHVQQTFR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 38/142 (27%)
metazoan_ACD 61..138 CDD:107247 24/85 (28%)
Hspb7NP_113795.1 IbpA 39..166 CDD:223149 39/149 (26%)
ACD_HspB7_like 72..152 CDD:107234 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342797
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.