DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hspb7

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001006040.1 Gene:hspb7 / 450019 ZFINID:ZDB-GENE-041010-136 Length:161 Species:Danio rerio


Alignment Length:76 Identity:23/76 - (30%)
Similarity:36/76 - (47%) Gaps:9/76 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DGYKLTLDVKDYSELKVKVLDESVVLVEGKSEQQEAEQ---GGYSSRHFLRRFVLPEGYEADKVT 123
            |.|:.|:||:|:|.      ::.:|.......:..||:   .|.....|..:..|||..:...|.
Zfish    71 DTYQFTVDVQDFSP------EDVIVTTSNNQIEVHAEKLASDGTVMNTFTHKCRLPEDVDPTSVK 129

  Fly   124 STLSSDGVLTI 134
            |:|.:||.|||
Zfish   130 SSLGADGTLTI 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 23/76 (30%)
metazoan_ACD 61..138 CDD:107247 23/76 (30%)
hspb7NP_001006040.1 ACD_HspB7_like 64..144 CDD:107234 23/76 (30%)
IbpA <65..158 CDD:223149 23/76 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582894
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.