DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hspb8

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001005658.1 Gene:hspb8 / 448147 XenbaseID:XB-GENE-945643 Length:202 Species:Xenopus tropicalis


Alignment Length:148 Identity:44/148 - (29%)
Similarity:68/148 - (45%) Gaps:27/148 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPMFWRMAEEMARMPRLSSPFHAFFHE--------PPVWSVALPRNWQQIARWQEQEFAPPATVN 60
            |.|.|   .:.|| |||:|.:......        |||::          :|:.....|.....|
 Frog    47 LTMDW---PDWAR-PRLTSAWSGPLRSGLVRSGMPPPVYN----------SRYTGYPDARNTVAN 97

  Fly    61 -KDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKV 122
             ...:|:.::|:.:  .||.||..| ..|.|.|..|:|:.| ||..|::|.::|.||...:|..|
 Frog    98 ISQPWKVCVNVQTFKPEELTVKTKD-GFVEVSGNHEEQQKE-GGIVSKNFTKKFQLPPEVDAQTV 160

  Fly   123 TSTLSSDGVLTISVPNPP 140
            .::||.:|:|.|..|..|
 Frog   161 FASLSPEGLLIIEAPVVP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 39/135 (29%)
metazoan_ACD 61..138 CDD:107247 27/78 (35%)
hspb8NP_001005658.1 alpha-crystallin-Hsps_p23-like 86..175 CDD:381838 29/90 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.