DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hspb8

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001005658.1 Gene:hspb8 / 448147 XenbaseID:XB-GENE-945643 Length:202 Species:Xenopus tropicalis


Alignment Length:148 Identity:44/148 - (29%)
Similarity:68/148 - (45%) Gaps:27/148 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPMFWRMAEEMARMPRLSSPFHAFFHE--------PPVWSVALPRNWQQIARWQEQEFAPPATVN 60
            |.|.|   .:.|| |||:|.:......        |||::          :|:.....|.....|
 Frog    47 LTMDW---PDWAR-PRLTSAWSGPLRSGLVRSGMPPPVYN----------SRYTGYPDARNTVAN 97

  Fly    61 -KDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKV 122
             ...:|:.::|:.:  .||.||..| ..|.|.|..|:|:.| ||..|::|.::|.||...:|..|
 Frog    98 ISQPWKVCVNVQTFKPEELTVKTKD-GFVEVSGNHEEQQKE-GGIVSKNFTKKFQLPPEVDAQTV 160

  Fly   123 TSTLSSDGVLTISVPNPP 140
            .::||.:|:|.|..|..|
 Frog   161 FASLSPEGLLIIEAPVVP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 27/78 (35%)
hspb8NP_001005658.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 86..175 CDD:469641 29/90 (32%)

Return to query results.
Submit another query.