DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and cryabb

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_021331756.1 Gene:cryabb / 436943 ZFINID:ZDB-GENE-040718-419 Length:180 Species:Danio rerio


Alignment Length:117 Identity:40/117 - (34%)
Similarity:65/117 - (55%) Gaps:20/117 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 WQEQEFAPPATVNKDGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQG-GYSSRHFLR 109
            |.|...: ...:.||.:.|:||||.::  ||.||::.:   .:|..::.::.:.| |:.||.|||
Zfish    49 WMESGVS-EVKMEKDQFSLSLDVKHFAPEELSVKIIGD---FIEIHAKHEDRQDGHGFVSREFLR 109

  Fly   110 RFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLK-----EREVTIEQT 156
            ::.:|.|.:...:||:||||||||::.|        ||     ||.:.|..|
Zfish   110 KYRVPVGVDPASITSSLSSDGVLTVTGP--------LKLSDGPERTIAIPVT 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 38/113 (34%)
metazoan_ACD 61..138 CDD:107247 31/79 (39%)
cryabbXP_021331756.1 Crystallin 1..48 CDD:306911
ACD_HspB4-5-6 56..137 CDD:107233 31/83 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582881
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.