DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and Hsp67Ba

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster


Alignment Length:124 Identity:50/124 - (40%)
Similarity:84/124 - (67%) Gaps:8/124 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ATVNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEA 119
            :.||::|::::::||.:  :||.||.:|..:| |||:.:::| :..|..||||:|:::||:||:.
  Fly   120 SVVNRNGFQVSMNVKQFAANELTVKTIDNCIV-VEGQHDEKE-DGHGVISRHFIRKYILPKGYDP 182

  Fly   120 DKVTSTLSSDGVLTISVPNP-PGVQETL--KEREVTIEQTGEPAK-KSAEEPNDKAASQ 174
            ::|.|||||||:||:..|.| |.|:.:|  :||.|.|:|..:..| |.|:.|......|
  Fly   183 NEVHSTLSSDGILTVKAPPPLPVVKGSLERQERIVDIQQISQQQKDKDAQPPKPSEVEQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 33/78 (42%)
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 33/77 (43%)
Agg_substance 226..>432 CDD:411439 5/16 (31%)

Return to query results.
Submit another query.