DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and CG7409

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster


Alignment Length:131 Identity:46/131 - (35%)
Similarity:66/131 - (50%) Gaps:22/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PVWSVALPR--NWQQIARWQEQEFAPPATVNKDGYKLTLDV---KDYSELKVKVLDESVVLVEGK 91
            |.|..:|.|  :...::|         ..|.|||::..:||   |.| |:.||...::|| ||.|
  Fly    33 PYWKRSLSRVGSAPDLSR---------VIVGKDGFEANVDVHLFKPY-EISVKTSGDTVV-VEAK 86

  Fly    92 SEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQT 156
            .|::. :...:..||.::|||||.||..:.|.|.|||||:||:..|     .....||.|.:.|.
  Fly    87 HEKRR-DGDTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCP-----PYLTNERSVYVRQV 145

  Fly   157 G 157
            |
  Fly   146 G 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 44/126 (35%)
metazoan_ACD 61..138 CDD:107247 34/79 (43%)
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 34/79 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.