DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hspb1

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001008615.2 Gene:hspb1 / 368243 ZFINID:ZDB-GENE-030326-4 Length:199 Species:Danio rerio


Alignment Length:160 Identity:48/160 - (30%)
Similarity:78/160 - (48%) Gaps:17/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MAEEMARMPRLSSP----------FHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGY 64
            ::|||...|....|          |.:....|||....:..::.:....|............|.:
Zfish    38 LSEEMLTFPSTHWPGYMRPFGHPEFASLMQGPPVMPPMMTPSYGRALSRQLSSGMSEVKQTGDSW 102

  Fly    65 KLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLS 127
            |::|||..:|  ||.||..| .|:.:.||.|:::.|. |:.||.|.|::.||.|.:::|::|.||
Zfish   103 KISLDVNHFSPEELNVKTKD-GVLEITGKHEERKDEH-GFISRCFTRKYTLPPGVDSEKISSCLS 165

  Fly   128 SDGVLTISVPNP-PGVQETLKEREVTIEQT 156
            .:||||:..|.| |.:|  ..|..:.:.:|
Zfish   166 PEGVLTVEAPLPKPAIQ--APEVNIPVNKT 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 44/149 (30%)
metazoan_ACD 61..138 CDD:107247 32/78 (41%)
hspb1NP_001008615.2 ACD_HspB1_like 91..176 CDD:107230 32/86 (37%)
IbpA <94..191 CDD:223149 37/100 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4974
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.