DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and Hspb9

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001102305.1 Gene:Hspb9 / 363681 RGDID:1309122 Length:203 Species:Rattus norvegicus


Alignment Length:190 Identity:46/190 - (24%)
Similarity:73/190 - (38%) Gaps:57/190 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ARMPRLSSPFHAFFHEP---------PVWSVALPRNWQQIARWQEQEFAPPATVNKD-------- 62
            :||.|:.|.|.....||         |  ||||..        :.|....|..:.||        
  Rat    33 SRMQRVGSSFSTGQREPGENRVASRCP--SVALSE--------RNQAATLPVRLLKDDLAAAHAN 87

  Fly    63 -----GYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQ--EAEQGGY---SSRHFLRRFVLPE 115
                 .:::.||...::  :|.|:: |...::|.||.:|:  :..:|.|   .|.|  |:..||.
  Rat    88 GCEEPSFQMKLDAHGFAPEDLVVRI-DGQNLMVTGKRQQESNDPSRGRYRLEQSVH--RQMQLPM 149

  Fly   116 GYEADKVTSTLSSDGVLTISVPNP----PGVQETLKEREVTIEQTGEP---AKKSAEEPN 168
            ..:...:|.:|:..|.|.....|.    |..|        |..|||:.   .:.|::.||
  Rat   150 TLDPAAMTCSLTPSGHLWFKGQNKCLPLPEAQ--------TGPQTGQALRFKRGSSKCPN 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 39/169 (23%)
metazoan_ACD 61..138 CDD:107247 22/96 (23%)
Hspb9NP_001102305.1 ACD_HspB9_like 87..172 CDD:107236 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342803
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.