DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and HSPB2

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001532.1 Gene:HSPB2 / 3316 HGNCID:5247 Length:182 Species:Homo sapiens


Alignment Length:110 Identity:32/110 - (29%)
Similarity:51/110 - (46%) Gaps:7/110 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTL 126
            ::..|||..::  |:.|:.:|.  :|.......|..::.|:.||.|.|.:|||...:..:|.:.|
Human    74 FQAFLDVSHFTPDEVTVRTVDN--LLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAAL 136

  Fly   127 SSDGVLTISVPNPPGVQETLKEREVTIEQTGEPAKKSAEEPNDKA 171
            |.||:|.:..|. .|.....:..||.|...  ||....||..:.|
Human   137 SHDGILNLEAPR-GGRHLDTEVNEVYISLL--PAPPDPEEEEEAA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 26/91 (29%)
metazoan_ACD 61..138 CDD:107247 22/75 (29%)
HSPB2NP_001532.1 alpha-crystallin-Hsps_p23-like 67..148 CDD:412199 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148888
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.