DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and HSPB1

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001531.1 Gene:HSPB1 / 3315 HGNCID:5246 Length:205 Species:Homo sapiens


Alignment Length:195 Identity:54/195 - (27%)
Similarity:81/195 - (41%) Gaps:58/195 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RMAEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARWQEQ-EFAPPATVNK----------- 61
            |:.::...:|||          |..||     .|...:.|... ...|||.:..           
Human    27 RLFDQAFGLPRL----------PEEWS-----QWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRA 76

  Fly    62 ----------------DGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFL 108
                            |.::::|||..::  ||.||..| .||.:.||.|:::.|. ||.||.|.
Human    77 LSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKD-GVVEITGKHEERQDEH-GYISRCFT 139

  Fly   109 RRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQT--------GEPAKKSAE 165
            |::.||.|.:..:|:|:||.:|.||:..|.|   :...:..|:||..|        |..|.||.|
Human   140 RKYTLPPGVDPTQVSSSLSPEGTLTVEAPMP---KLATQSNEITIPVTFESRAQLGGPEAAKSDE 201

  Fly   166  165
            Human   202  201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 46/166 (28%)
metazoan_ACD 61..138 CDD:107247 31/105 (30%)
HSPB1NP_001531.1 Interaction with TGFB1I1. /evidence=ECO:0000250 70..205 42/137 (31%)
ACD_HspB1_like 84..169 CDD:107230 31/86 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.