DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and CG14207

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster


Alignment Length:150 Identity:45/150 - (30%)
Similarity:69/150 - (46%) Gaps:26/150 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RMAEEMARMPRLSSPFHAFFHE-----------PPVWSVALPRNWQQIARWQE--QEFAPPATVN 60
            :|.||||:.........|.|.|           ....:.|||   .:|.:.|.  .:.:.| .:.
  Fly    36 KMEEEMAKFRHELMNREANFFESTSSTKKTTTTSSTTNSALP---SRIPKQQNYVSDISSP-LIQ 96

  Fly    61 KDG----YKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEA 119
            .:|    .||..||..|:  |:.||.:|:. :||..|.|::...:..|  |.:.|.|:||:|...
  Fly    97 DEGDNKVLKLRFDVSQYAPEEIVVKTVDQK-LLVHAKHEEKSDTKSVY--REYNREFLLPKGVNP 158

  Fly   120 DKVTSTLSSDGVLTISVPNP 139
            :.:.|:||.|||||:..|.|
  Fly   159 ESIRSSLSKDGVLTVDAPLP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 39/141 (28%)
metazoan_ACD 61..138 CDD:107247 29/82 (35%)
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 29/83 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452105
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.