DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hsp16

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_596091.1 Gene:hsp16 / 2540977 PomBaseID:SPBC3E7.02c Length:143 Species:Schizosaccharomyces pombe


Alignment Length:149 Identity:36/149 - (24%)
Similarity:67/149 - (44%) Gaps:32/149 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FFHEPPVWSVAL-------PRNWQQIARWQEQEFAPPATVNKDGYKLTLDVK-----------DY 73
            ||..||..:...       ||...||    ..|.:|...|::....:::||:           .|
pombe     6 FFGFPPTVNDLFSDFVSYSPRLNNQI----PGELSPSIDVHEGKDTVSVDVELPGVKKEDVQVHY 66

  Fly    74 SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRH---FLRRFVLPEGYEADKVTSTLSSDGVLTIS 135
            ...|:.:..|  |:.|.|:|..|..| .:|.|.   |.|...:|...:||::.:.. |:|:||::
pombe    67 DSGKLTISGE--VVNERKNESTEGNQ-RWSERRFGSFSRTITIPAKIDADRIEANF-SNGLLTVT 127

  Fly   136 VPNPPGVQETLKEREVTIE 154
            :|.   |:::..::::.|:
pombe   128 LPK---VEKSQTKKQIAIK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 35/147 (24%)
metazoan_ACD 61..138 CDD:107247 22/90 (24%)
hsp16NP_596091.1 IbpA 1..143 CDD:223149 35/147 (24%)
ACD_sHsps-like 40..130 CDD:107221 23/93 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100183
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.