DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hsp20

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_588161.1 Gene:hsp20 / 2538739 PomBaseID:SPCC338.06C Length:139 Species:Schizosaccharomyces pombe


Alignment Length:89 Identity:22/89 - (24%)
Similarity:46/89 - (51%) Gaps:11/89 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KDGYKLTLDVKDYSELKVKV-LDESVVLVEGKSEQQEAEQGG----YSSR---HFLRRFVLPEGY 117
            :|..::.::|....:..:|| |..|.:.:.|:.::.|.|:.|    :|.|   .|.|...||:..
pombe    42 EDTIEVDVEVPGIDKQNLKVDLHGSKLTISGERKKPEEEKAGPLIRWSERCVGAFSRTITLPQPV 106

  Fly   118 EADKVTSTLSSDGVLTISV--PNP 139
            :...:.::| ::|:|:|.:  .||
pombe   107 DEKLIHASL-NNGILSIVMKKKNP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 20/86 (23%)
hsp20NP_588161.1 IbpA 37..139 CDD:439841 22/89 (25%)

Return to query results.
Submit another query.