DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and Cryaa

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001276666.1 Gene:Cryaa / 24273 RGDID:2413 Length:196 Species:Rattus norvegicus


Alignment Length:143 Identity:44/143 - (30%)
Similarity:72/143 - (50%) Gaps:25/143 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HAFF--HEPPVWSVALPRNWQQIARWQEQEFAPPATV--NKDGYKLTLDVKDYS--ELKVKVLDE 83
            |.:|  |:|...:   |:|             .|..|  ::|.:.:.||||.:|  :|.|||| |
  Rat    67 HMWFVMHQPHAGN---PKN-------------NPGKVRSDRDKFVIFLDVKHFSPEDLTVKVL-E 114

  Fly    84 SVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPN-PPGVQETLK 147
            ..|.:.||..::: :..||.||.|.||:.||...:...::.:||:||:||.|.|. ..|:.....
  Rat   115 DFVEIHGKHNERQ-DDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHS 178

  Fly   148 EREVTIEQTGEPA 160
            ||.:.:.:..:|:
  Rat   179 ERAIPVSREEKPS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 43/135 (32%)
metazoan_ACD 61..138 CDD:107247 31/78 (40%)
CryaaNP_001276666.1 Crystallin 1..51 CDD:395419
alpha-crystallin-Hsps_p23-like 86..168 CDD:412199 32/83 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342791
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.