DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and ZK1128.7

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_499252.2 Gene:ZK1128.7 / 191528 WormBaseID:WBGene00014233 Length:205 Species:Caenorhabditis elegans


Alignment Length:81 Identity:22/81 - (27%)
Similarity:44/81 - (54%) Gaps:6/81 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TVNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYS-SRHFLRRFVLPEGYEA 119
            |....|:.:.:||..:  .|:||.:.|:::.:   ..|:.|:...|:: .|.|.|::.:|:....
 Worm    98 TNTSHGFTIEIDVFHFMPEEIKVVLTDDTLSI---SGERFESTGDGHTLRRSFSRKYSIPDDVHL 159

  Fly   120 DKVTSTLSSDGVLTIS 135
            |.:.|.|::.|||.|:
 Worm   160 DTIRSHLTNSGVLIIN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 22/81 (27%)
metazoan_ACD 61..138 CDD:107247 21/78 (27%)
ZK1128.7NP_499252.2 metazoan_ACD 96..178 CDD:107247 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100183
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.