DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and Y55F3BR.6

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001368623.1 Gene:Y55F3BR.6 / 190317 WormBaseID:WBGene00021943 Length:253 Species:Caenorhabditis elegans


Alignment Length:106 Identity:35/106 - (33%)
Similarity:51/106 - (48%) Gaps:4/106 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADK 121
            |....:...|||..|  ..|||.|:|.::: |||...::|...|...|. |.|||.||:....:.
 Worm   149 VTNTSFHAILDVSKYDADSLKVTVVDNNII-VEGSHGEKEDTYGTIEST-FKRRFPLPKAVAPES 211

  Fly   122 VTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTGEPAKK 162
            |.|.|::||.|||....|...||..:..::.:..|....:|
 Worm   212 VQSQLTADGHLTIDAKAPEPKQEGARPIQIKVINTSAEQQK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 33/96 (34%)
metazoan_ACD 61..138 CDD:107247 29/78 (37%)
Y55F3BR.6NP_001368623.1 metazoan_ACD 150..227 CDD:107247 29/78 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.