DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and F58H7.1

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001343638.1 Gene:F58H7.1 / 186550 WormBaseID:WBGene00019067 Length:692 Species:Caenorhabditis elegans


Alignment Length:178 Identity:35/178 - (19%)
Similarity:62/178 - (34%) Gaps:64/178 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NWQQI---ARWQEQEFAPPATVNKDGYKLTLDVKDYSELKVKVL---DESVVLVEGKSEQQ-EAE 98
            |::.|   |.|::.|....:.:.....||.: :.|:||.|.::.   ||..|.:|...:|: :.|
 Worm   312 NFESIYITAGWKDTEMDRRSNLTTGVVKLRV-ICDHSETKEEIKLKGDEDSVTIEITMDQKYDIE 375

  Fly    99 QGGYSSRHFLRRFVLP---------------------------EGYEADKVTSTLSSDGVLTISV 136
            :   ..:|.::..:.|                           |..|....|||.....:..:||
 Worm   376 E---MEKHHIKAHITPLKCHKICWTTDLVLSSGFGDFTKHLGSECKEISGTTSTTFLRNIKKVSV 437

  Fly   137 PNPPGVQETLKEREVTIE---------------------QTGEPAKKS 163
                 ::..|.|.|:.:|                     .|.||.||:
 Worm   438 -----IENQLSENELVVETEVPESEYGIVTLILQKLGGNDTEEPVKKT 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 29/146 (20%)
metazoan_ACD 61..138 CDD:107247 21/107 (20%)
F58H7.1NP_001343638.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.