Sequence 1: | NP_001027114.1 | Gene: | Hsp22 / 3772576 | FlyBaseID: | FBgn0001223 | Length: | 174 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001123107.2 | Gene: | hsp-43 / 180895 | WormBaseID: | WBGene00002024 | Length: | 393 | Species: | Caenorhabditis elegans |
Alignment Length: | 210 | Identity: | 44/210 - (20%) |
---|---|---|---|
Similarity: | 80/210 - (38%) | Gaps: | 54/210 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 RSLPMFWRMAEEMARMPRLSSPFHAFFHEPPVW-----------SVALP----------RNWQQ- 44
Fly 45 ------IARWQEQEFAPPATVN----KDGYKLTLDVKDY----SELKVKVLDESVVLVEGKSEQQ 95
Fly 96 EAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTGEPA 160
Fly 161 K-------KSAEEPN 168 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hsp22 | NP_001027114.1 | IbpA | 17..154 | CDD:223149 | 35/172 (20%) |
metazoan_ACD | 61..138 | CDD:107247 | 18/80 (23%) | ||
hsp-43 | NP_001123107.2 | metazoan_ACD | 107..186 | CDD:107247 | 18/80 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45640 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |