DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hsp-25

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001024374.1 Gene:hsp-25 / 180872 WormBaseID:WBGene00002023 Length:219 Species:Caenorhabditis elegans


Alignment Length:82 Identity:30/82 - (36%)
Similarity:49/82 - (59%) Gaps:7/82 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DG--YKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKV 122
            ||  .:|..||.:|  .|:.||.:|.. :||..|.|::..::..:  |.:.:.|:||.|...:::
 Worm   135 DGKTLRLRFDVANYKPEEVTVKTIDNR-LLVHAKHEEKTPQRTVF--REYNQEFLLPRGTNPEQI 196

  Fly   123 TSTLSSDGVLTISVPNP 139
            :||||:|||||:..|.|
 Worm   197 SSTLSTDGVLTVEAPLP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 30/82 (37%)
metazoan_ACD 61..138 CDD:107247 28/79 (35%)
hsp-25NP_001024374.1 metazoan_ACD 131..212 CDD:107247 28/79 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.