DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and Hspb1

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_038588.2 Gene:Hspb1 / 15507 MGIID:96240 Length:209 Species:Mus musculus


Alignment Length:206 Identity:57/206 - (27%)
Similarity:85/206 - (41%) Gaps:60/206 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PMFWRMAEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARW---------------QEQEFA 54
            |...|:.::...:|||          |..||     .|...|.|               .....|
Mouse    24 PAHSRLFDQAFGVPRL----------PDEWS-----QWFSAAGWPGYVRPLPAATAEGPAAVTLA 73

  Fly    55 PPA---TVNK-------------DGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGG 101
            .||   .:|:             |.::::|||..::  ||.||. .|.||.:.||.|:::.|. |
Mouse    74 APAFSRALNRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKT-KEGVVEITGKHEERQDEH-G 136

  Fly   102 YSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTI-------EQTGEP 159
            |.||.|.|::.||.|.:...|:|:||.:|.||:..|.|..|.::   .|:||       .|.|.|
Mouse   137 YISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQS---AEITIPVTFEARAQIGGP 198

  Fly   160 AKKSAEEPNDK 170
            ....:|:...|
Mouse   199 EAGKSEQSGAK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 50/176 (28%)
metazoan_ACD 61..138 CDD:107247 31/91 (34%)
Hspb1NP_038588.2 Interaction with TGFB1I1. /evidence=ECO:0000250 74..209 44/139 (32%)
ACD_HspB1_like 88..173 CDD:107230 31/86 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.