DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and CRYAB

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001276736.1 Gene:CRYAB / 1410 HGNCID:2389 Length:175 Species:Homo sapiens


Alignment Length:163 Identity:55/163 - (33%)
Similarity:85/163 - (52%) Gaps:27/163 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PFHA-------FFHE--------PPVWSVA----LPRNWQQIARWQEQEFAPPATVNKDGYKLTL 68
            |||:       ||.|        |...|::    .|.::.:...|.:...: ...:.||.:.:.|
Human    16 PFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLS-EMRLEKDRFSVNL 79

  Fly    69 DVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGV 131
            |||.:|  |||||||.: |:.|.||.|:::.|. |:.||.|.|::.:|...:...:||:||||||
Human    80 DVKHFSPEELKVKVLGD-VIEVHGKHEERQDEH-GFISREFHRKYRIPADVDPLTITSSLSSDGV 142

  Fly   132 LTISVPNPPGVQETLKEREVTIEQTGEPAKKSA 164
            ||:   |.|..|.:..||.:.|.:..:||..:|
Human   143 LTV---NGPRKQVSGPERTIPITREEKPAVTAA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 51/151 (34%)
metazoan_ACD 61..138 CDD:107247 36/78 (46%)
CRYABNP_001276736.1 Crystallin 1..52 CDD:395419 8/35 (23%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 38/87 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..175 9/27 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148910
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.