DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and CRYAA2

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001300979.1 Gene:CRYAA2 / 102724652 -ID:- Length:173 Species:Homo sapiens


Alignment Length:147 Identity:44/147 - (29%)
Similarity:70/147 - (47%) Gaps:13/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FHAFFHE--------PPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYS--ELKV 78
            |..||.|        |.:.|...|...|.:.|............::|.:.:.||||.:|  :|.|
Human    23 FDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTV 87

  Fly    79 KVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPN-PPGV 142
            ||.|: .|.:.||..::: :..||.||.|.||:.||...:...::.:||:||:||...|. ..|:
Human    88 KVQDD-FVEIHGKHNERQ-DDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGL 150

  Fly   143 QETLKEREVTIEQTGEP 159
            ..|..||.:.:.:..:|
Human   151 DATHAERAIPVSREEKP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 43/140 (31%)
metazoan_ACD 61..138 CDD:107247 29/78 (37%)
CRYAA2NP_001300979.1 Crystallin 1..51 CDD:395419 7/27 (26%)
ACD_alphaA-crystallin_HspB4 60..145 CDD:107245 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148921
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.