DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and cryab

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_002932964.1 Gene:cryab / 100494321 XenbaseID:XB-GENE-971379 Length:173 Species:Xenopus tropicalis


Alignment Length:142 Identity:48/142 - (33%)
Similarity:71/142 - (50%) Gaps:22/142 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SPFHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYS--ELKVKVLDES 84
            |||  ||..|          :.::..|.:...: ...::||.:.:.||||.:|  ||.||||.: 
 Frog    44 SPF--FFRYP----------FSRLPNWIDSGLS-EMKIDKDRFSVNLDVKHFSPEELNVKVLGD- 94

  Fly    85 VVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPN-----PPGVQE 144
            .:.:.|..|:::.|. ||.||.|.||:.:|...:...:|||||.|||||:|.|.     |.....
 Frog    95 FIEIHGTHEERQDEH-GYVSRDFQRRYKIPSDVDPQSITSTLSPDGVLTVSGPRKVSEVPERCIP 158

  Fly   145 TLKEREVTIEQT 156
            ..:|.:|.|..|
 Frog   159 ITREEKVAISST 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 46/138 (33%)
metazoan_ACD 61..138 CDD:107247 35/78 (45%)
cryabXP_002932964.1 Crystallin 1..51 CDD:366148 5/8 (63%)
alpha-crystallin-Hsps_p23-like 65..148 CDD:381838 36/84 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.