DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hspb3

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_002941074.1 Gene:hspb3 / 100135387 XenbaseID:XB-GENE-969539 Length:145 Species:Xenopus tropicalis


Alignment Length:121 Identity:29/121 - (23%)
Similarity:54/121 - (44%) Gaps:14/121 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HAFFHEP-PVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDY--SELKVKVLDESVV 86
            |..|..| |..|....|...|:...||::         |.:|:.|||..:  .::.::|. |..:
 Frog    32 HMLFALPGPQCSDHKKREDGQLDDQQEED---------DKFKVLLDVVQFRPEDIIIQVF-EGWL 86

  Fly    87 LVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGV 142
            :::|: .....::.|:.||.|.|.:.||.|.....:::....||:|.:......|:
 Frog    87 IIKGE-HGCRMDEHGFISRSFTRTYQLPNGIGLTDLSAFFCHDGILAVEGKQKQGL 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 29/121 (24%)
metazoan_ACD 61..138 CDD:107247 19/78 (24%)
hspb3XP_002941074.1 alpha-crystallin-Hsps_p23-like 55..137 CDD:381838 21/92 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.