DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and cryaa

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_694482.1 Gene:cryaa / 100000769 ZFINID:ZDB-GENE-020508-1 Length:173 Species:Danio rerio


Alignment Length:109 Identity:43/109 - (39%)
Similarity:59/109 - (54%) Gaps:8/109 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VNKDGYKLT--LDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEA 119
            |..|..|.|  ||||.:|  ||.|||.|: .|.::||..::: :..||.||.|.||:.||...:.
Zfish    65 VRSDREKFTVYLDVKHFSPDELSVKVTDD-YVEIQGKHGERQ-DDHGYISREFHRRYRLPSNVDQ 127

  Fly   120 DKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTGEPAKKS 163
            ..:|.|||:||:||:..|...|:.....:|  ||..|.|....|
Zfish   128 SAITCTLSADGLLTLCGPKTSGIDAGRGDR--TIPVTREDKSNS 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 39/98 (40%)
metazoan_ACD 61..138 CDD:107247 34/80 (43%)
cryaaNP_694482.1 Crystallin 1..48 CDD:278926
alpha-crystallin-Hsps_p23-like 61..146 CDD:294116 35/82 (43%)
IbpA <64..146 CDD:223149 35/82 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582888
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.