DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33884 and H2BC4

DIOPT Version :10

Sequence 1:NP_001027345.1 Gene:His2B:CG33884 / 3772575 FlyBaseID:FBgn0053884 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_003517.2 Gene:H2BC4 / 8347 HGNCID:4757 Length:126 Species:Homo sapiens


Alignment Length:100 Identity:23/100 - (23%)
Similarity:43/100 - (43%) Gaps:25/100 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   729 DMINRPKLLVDGPYGA-PAQDYRSYDVLLLIGLGIGATPFISILKDLLNNS----------RDEQ 782
            :|:...:.:|..|:|. |.|:|           |:|..||:.:.:...:||          .|::
Human   755 EMLPAQQKMVPLPFGEHPQQEY-----------GVGPRPFLPMSQGPGSNSGLRNLREPIGPDQR 808

  Fly   783 TDNEFSRS---DFSWNSCTSSYTTATPTSTHGGKK 814
            |::..|..   ..:.:|..:|.:||.|.....|:|
Human   809 TNSRLSHMPPLPLNPSSNPTSLSTAPPVQRGLGRK 843

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33884NP_001027345.1 HFD_H2B 33..120 CDD:467035
H2BC4NP_003517.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
HFD_H2B 30..123 CDD:467035
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.