DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33884 and His2B:CG33878

DIOPT Version :10

Sequence 1:NP_001027345.1 Gene:His2B:CG33884 / 3772575 FlyBaseID:FBgn0053884 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001027360.1 Gene:His2B:CG33878 / 3771891 FlyBaseID:FBgn0053878 Length:123 Species:Drosophila melanogaster


Alignment Length:122 Identity:26/122 - (21%)
Similarity:41/122 - (33%) Gaps:43/122 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   833 WFRGVMEEISDMDC--------RGQIELHNYLTSVYDE-----------------GD---ARSTL 869
            |.|...:.:..:.|        |.|:..|..|.:|:|:                 ||   .|.:.
  Fly    14 WIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAFVAPSASVIGDVHIGRGSS 78

  Fly   870 IKMVQALNHAKHGVDILSGTRVR----THFARPNWKEVFSSIARKHP-----NSTVG 917
            |.....|....:.|.:.|||.::    .|.|:.|..      .:.||     |.|:|
  Fly    79 IWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLS------GKVHPTIIGDNVTIG 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33884NP_001027345.1 HFD_H2B 33..120 CDD:467035
His2B:CG33878NP_001027360.1 HFD_H2B 33..120 CDD:467035 19/92 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.