DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33884 and H2BW2

DIOPT Version :9

Sequence 1:NP_001027345.1 Gene:His2B:CG33884 / 3772575 FlyBaseID:FBgn0053884 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_011529224.1 Gene:H2BW2 / 286436 HGNCID:27867 Length:154 Species:Homo sapiens


Alignment Length:135 Identity:55/135 - (40%)
Similarity:83/135 - (61%) Gaps:20/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTSGKAAKKAGKA-----QKNITKTDKKKKR-----KRK----------ESYAIYIYKVLKQVHP 48
            :.|.:...:.|::     :.|.||..|:|:|     :|:          :|:..|..:||||||.
Human     9 EASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSRRRHANRRGDSFGDSFTPYFPRVLKQVHQ 73

  Fly    49 DTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGT 113
            ...:|.:|:|:|:|.::||.:|||.||.:||||.||.|||||:||.||||||||::.|.|.::||
Human    74 GLSLSQEAVSVMDSMIHDILDRIATEAGQLAHYTKRVTITSRDIQMAVRLLLPGKMGKLAEAQGT 138

  Fly   114 KAVTK 118
            .|..:
Human   139 NAALR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33884NP_001027345.1 H2B 33..121 CDD:197718 46/86 (53%)
H2BW2XP_011529224.1 H2B <58..145 CDD:355063 46/86 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.