DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33884 and LOC100365043

DIOPT Version :9

Sequence 1:NP_001027345.1 Gene:His2B:CG33884 / 3772575 FlyBaseID:FBgn0053884 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_038952072.1 Gene:LOC100365043 / 100365043 RGDID:2319827 Length:126 Species:Rattus norvegicus


Alignment Length:129 Identity:104/129 - (80%)
Similarity:108/129 - (83%) Gaps:9/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP-PKTSGKAAKKAG-----KAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSI 59
            || |..|..|.||..     ||||   |..||:||.|||||::|:||||||||||||||||||.|
  Rat     1 MPEPAKSAPAPKKGSKKAVTKAQK---KDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGI 62

  Fly    60 MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            |||||||||||||.||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    63 MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33884NP_001027345.1 H2B 33..121 CDD:197718 82/87 (94%)
LOC100365043XP_038952072.1 H2B 28..124 CDD:197718 88/95 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100082
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.