DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fuca and FUC1

DIOPT Version :9

Sequence 1:NP_001303363.1 Gene:Fuca / 3772574 FlyBaseID:FBgn0285958 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_180377.2 Gene:FUC1 / 817355 AraportID:AT2G28100 Length:506 Species:Arabidopsis thaliana


Alignment Length:361 Identity:95/361 - (26%)
Similarity:139/361 - (38%) Gaps:115/361 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PLP-----QWYDDAKVGIFLHYGVYSVPSFGSEWFWTNWKNLRNPEYVQFMQRNYKPDFTYQEFA 104
            |||     || ....:.:|||:|    |:..::..|...|  .||                    
plant    36 PLPSSQQLQW-QLGSMAMFLHFG----PNTFTDSEWGTGK--ANP-------------------- 73

  Fly   105 SQFTAELFNATKWALLFKDSGARYVVLTSKHHDGFTLWPSK------NSYGWNSMDVGPKRDIVK 163
            |.|.....||::|..:.||||...|:||:||||||.||||:      .|..|.: ..|   |:|.
plant    74 SIFNPTHLNASQWVQIAKDSGFSRVILTAKHHDGFCLWPSEYTDYSVKSSQWRN-GAG---DVVA 134

  Fly   164 ELAAAIRKESDLRFGLYYSLFEW------------FNPLWTDDKLHLLMQQHFVERKVRPEQMEL 216
            |||:| .||:.:..|||.|  .|            :|..:..                  :..||
plant   135 ELASA-AKEAGIGLGLYLS--PWDRHEQCYGKTLEYNEFYLS------------------QMTEL 178

  Fly   217 VQQYLPEI--IWSD---GDWEAPAKYWRSEEFIAW---LYNDSPVRDTVVTND-----RWGFGTA 268
            :.:| .||  :|.|   ||.|...:|:    |..|   ::...|  ..|:.:|     ||....|
plant   179 LTKY-GEIKEVWLDGAKGDGEKDMEYF----FDTWFSLIHQLQP--KAVIFSDAGPDVRWIGDEA 236

  Fly   269 CMHGDFYNCADRFNPGVLQAHKWENAFTLDRTSWGQRF-----DVSLSD--FMTSKEVIKEII-- 324
            .:.|.  .|...||....:....|.:::.:...:||.:     |||:..  |..:.|..|..:  
plant   237 GLAGS--TCWSLFNRTNAKIGDTEPSYSQEGDGYGQDWVPAECDVSIRPGWFWHASESPKPAVQL 299

  Fly   325 -----TTVSCNGNVLINVGPTKFGTI----LPIFEE 351
                 .:|..|...|:||.|...|.|    :.:.||
plant   300 LDIYYNSVGRNCLFLLNVPPNSSGLISEQDIKVLEE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucaNP_001303363.1 Alpha_L_fucos 28..409 CDD:214829 95/361 (26%)
AfuC 60..>373 CDD:226195 88/341 (26%)
Fucosidase_C 376..492 CDD:293362
FUC1NP_180377.2 AfuC 28..477 CDD:226195 95/361 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3669
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002668
OrthoInspector 1 1.000 - - oto3450
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1781
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.