DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fuca and plxnb3

DIOPT Version :9

Sequence 1:NP_001303363.1 Gene:Fuca / 3772574 FlyBaseID:FBgn0285958 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_002935540.2 Gene:plxnb3 / 100490083 XenbaseID:XB-GENE-856492 Length:1925 Species:Xenopus tropicalis


Alignment Length:130 Identity:29/130 - (22%)
Similarity:48/130 - (36%) Gaps:47/130 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 ASN----GKITIYAFVLE-------YPYDTNEL-DIYPL------GKDINIFRNVMLTG----ID 434
            |||    |.:.:|...|:       :.|....| .::||      |..|.|..:.:|||    |.
 Frog   934 ASNAEESGPVEVYVDALQPGVSVEHFTYQDPVLQSLHPLQGPIAGGTLITITGSKLLTGDLINIT 998

  Fly   435 MG-------------------TGGDILNEQSTEVVMLG-----MEDTKIKWNADHNRLHIVFPPK 475
            :|                   ||...:.|:....|..|     :||||..: .::..:.:|:|.:
 Frog   999 VGDIPCKIPNGGVAEGEIHCVTGASSVLEELPVSVFYGSAKRILEDTKYSY-TENPTISLVYPSR 1062

  Fly   476  475
             Frog  1063  1062

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucaNP_001303363.1 Alpha_L_fucos 28..409 CDD:214829 6/27 (22%)
AfuC 60..>373 CDD:226195
Fucosidase_C 376..492 CDD:293362 29/130 (22%)
plxnb3XP_002935540.2 Sema_plexin_B3 81..513 CDD:200538
PSI 515..563 CDD:366642
TIG_plexin 574..660 CDD:375449
PSI 674..>703 CDD:366642
TIG_2 726..825 CDD:375492
IPT 874..963 CDD:387656 7/28 (25%)
IPT 964..1051 CDD:387656 20/87 (23%)
IPT 1053..1173 CDD:387656 2/10 (20%)
Plexin_cytopl 1356..1891 CDD:369821
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165168992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.