DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and Prss36

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:245 Identity:83/245 - (33%)
Similarity:124/245 - (50%) Gaps:31/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 SRIVGGTSTTISTTPYIVQLRR-GSNLCSGSLITEQWVLTAAHC--VKG--YSASDFTVRGGTTT 166
            ||||||:.....|.|:.|.|.: |.::|.||||...|||:||||  ..|  ..|.:.:|..|..:
Mouse    46 SRIVGGSDAHPGTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADELSVLLGVHS 110

  Fly   167 LDGS-DGV-TRSVSSIHVAPKFTSKKMNMDAALLKL-NQSLTGTNIGTISMGNYRPKA------G 222
            .||. :|. .|||::|.:...:::.::..|.|||:| :.:..|.::..:.:    |:|      |
Mouse   111 QDGPLEGAHMRSVATILIPDNYSTVELGADLALLRLASPAKLGPSVRPVCL----PRASHLFAHG 171

  Fly   223 SRVRIAGWGVTKEG-STTASKTLQTAQIRVVRQQKCRKDYR--GQATIT----KYMLCA--RAAG 278
            :.....|||..:|. .......||..::|::.:..|:..|.  |...:|    ..||||  .|..
Mouse   172 TACWATGWGDVQEAVPLPLPWVLQEVELRLLGEAACQCLYSRPGPFNLTFQLLPGMLCAGYPAGR 236

  Fly   279 KDSCSGDSGGPVTRNN----TLLGIVSFGYGCARAGYPGVYTAVVAIRQW 324
            :|:|.||||||:...:    .|.||.|||:||.|...|||:|||.....|
Mouse   237 RDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAPYESW 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 81/242 (33%)
Tryp_SPc 121..324 CDD:238113 75/229 (33%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 81/243 (33%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.