DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and Prss55

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_008769022.1 Gene:Prss55 / 683415 RGDID:1586875 Length:321 Species:Rattus norvegicus


Alignment Length:237 Identity:73/237 - (30%)
Similarity:113/237 - (47%) Gaps:20/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 SRIVGGTSTTISTTPYIVQLRRGS-NLCSGSLITEQWVLTAAHCV--KGYSASDFTVRGGTTTLD 168
            |||:||....:...|:.|.::... :.|.||:::|.|:||.|||.  :..|.::.|||.||..|.
  Rat    33 SRIIGGQEAEVGEFPWQVSIQENDHHFCGGSILSEWWILTVAHCFYSQELSPTELTVRVGTNDLT 97

  Fly   169 GSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTNIGTISMG---NYRPKAGSRVRIAGW 230
            .|. :...|::|.....|....|:.|.|||.|...|| .|..|:.:.   ...|.:.....:|||
  Rat    98 TSP-MELQVTNIIRHKDFKRHSMDNDIALLLLANPLT-FNEQTVPICMPLQPTPPSWQECWVAGW 160

  Fly   231 GVTKEG-STTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARAAGK--DSCSGDSGGPVTR 292
            |.|... ..:.:..|....:|:...::|.:.:   .::|..||||....:  |:|.||||||:..
  Rat   161 GTTNSADKESMNMDLMKVPMRITDWKECLQLF---PSLTTNMLCASYGNESFDACQGDSGGPLVC 222

  Fly   293 NNT------LLGIVSFGYGCARAGYPGVYTAVVAIRQWATNI 328
            |..      .:||:|:|..|.:.|.||:||.:.....|...|
  Rat   223 NQESDGRWYQVGIISWGKSCGQKGSPGIYTVLANYILWIEKI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 70/230 (30%)
Tryp_SPc 121..324 CDD:238113 66/217 (30%)
Prss55XP_008769022.1 Tryp_SPc 35..264 CDD:238113 70/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.