DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG17242

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:204 Identity:49/204 - (24%)
Similarity:81/204 - (39%) Gaps:25/204 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 CSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNM---- 193
            |.|.:.:|..:||.|.||:.......:||.|:.. :.:.|....|           :||.:    
  Fly    41 CGGVIYSEDIILTIAECVRKARLEFISVRVGSAQ-ENAGGTVLKV-----------EKMRLQVLG 93

  Fly   194 ----DAALLKLNQSL-TGTNIGTISMGNYRPKAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVR 253
                |.|:|:|...| ....|..|.:.......|:...::||| .......:|:.|....:::..
  Fly    94 LRPSDVAILQLRSPLYLDGGIRAIPLATIPLVPGTNASVSGWG-QLSAMNPSSEVLLRVDVKIQD 157

  Fly   254 QQKCRKDYRGQATITKY-MLCARAAGK--DSCSGDSGGPVTRNNTLLGIVSFGYGCARAGYPGVY 315
            |..|..:...:..:... .:||..||:  .:|.|..|||:..||.|.||:|:...|.......||
  Fly   158 QLMCATNLALKGRLMSVGEICAAPAGEIPYACQGFVGGPLVANNRLYGILSWQSACDVLNKSSVY 222

  Fly   316 TAVVAIRQW 324
            ..:...:.|
  Fly   223 ANIAMFKVW 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 48/202 (24%)
Tryp_SPc 121..324 CDD:238113 48/202 (24%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 49/204 (24%)
Tryp_SPc 24..232 CDD:214473 49/204 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.