DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG17234

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:255 Identity:75/255 - (29%)
Similarity:123/255 - (48%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LSAKRVNQNKKAATSSKIQSRIVGGTSTTISTTPYIVQLRR-GSNLCSGSLITEQWVLTAAHCV- 150
            |||.:||         :.:.||:||....|...|:.|.|:. |.::|.||:.:|..::|||||. 
  Fly    15 LSAGQVN---------RWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFF 70

  Fly   151 --KGYSASD--FTVRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTN-IG 210
              :|....|  :.||.|:...| |:|....|:::.:..::.......|.|:::|:..|..|: :.
  Fly    71 DEEGNRLDDQGYQVRAGSALTD-SNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQ 134

  Fly   211 TISMGNYRPKAGSRVRIAGWGVT--KEGSTTASKT-LQTAQIRVVRQQKCRKDYRGQATITKYML 272
            .|.:....|...|...::||||:  ...||....| ||...:.:.....||       .....:|
  Fly   135 PIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR-------LFDPSLL 192

  Fly   273 CARAAGKDSCSGDSGGPVTRNNTLLGIVSFG-YGCARAGYPGVYTAVVAIRQWATNIMAN 331
            ||...|:.:|.||||||:..|..|:|:||:| .||..:.:   :.:|...|:|..|.:|:
  Fly   193 CAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILNAIAS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 67/226 (30%)
Tryp_SPc 121..324 CDD:238113 62/213 (29%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 67/227 (30%)
Tryp_SPc 27..243 CDD:238113 66/226 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.