DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and Prss36

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:245 Identity:82/245 - (33%)
Similarity:122/245 - (49%) Gaps:31/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 SRIVGGTSTTISTTPYIVQLRR-GSNLCSGSLITEQWVLTAAHC--VKG--YSASDFTVRGGTTT 166
            ||||||:.....|.|:.|.|.. |.::|.||||...|||:||||  ..|  ..|.:::|..|..:
  Rat    57 SRIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEWSVLLGVHS 121

  Fly   167 LDGS-DGV-TRSVSSIHVAPKFTSKKMNMDAALLKL-NQSLTGTNIGTISMGNYRPKA------G 222
            .||. :|. .|||::|.|...::..::..|.|||:| :.:..|.::..:.:    |:|      |
  Rat   122 QDGPLEGAHMRSVATILVPDNYSRVELGADLALLRLASPAKLGPSVKPVCL----PRASHLFAHG 182

  Fly   223 SRVRIAGWGVTKEGS-TTASKTLQTAQIRVVRQQKCRKDYR--GQATITKY----MLCA--RAAG 278
            :.....|||..:|.. ......||..:::::.:..|:..|.  |...:|..    ||||  ....
  Rat   183 TACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQLLPGMLCAGYPEGR 247

  Fly   279 KDSCSGDSGGPVTRNN----TLLGIVSFGYGCARAGYPGVYTAVVAIRQW 324
            :|:|.||||||:...:    .|.||.|||:||.|...|||:|||.....|
  Rat   248 RDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAHYESW 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 80/242 (33%)
Tryp_SPc 121..324 CDD:238113 74/229 (32%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 80/243 (33%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.