DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and deltaTry

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster


Alignment Length:224 Identity:90/224 - (40%)
Similarity:135/224 - (60%) Gaps:4/224 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 KIQSRIVGGTSTTISTTPYIVQLRR-GSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTL 167
            ::..|||||::||||:.|:.:.|:| ||:.|.||:.:...::|||||::..|||...:|.|::..
  Fly    26 QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYW 90

  Fly   168 DGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLT-GTNIGTISMGNYRPKAGSRVRIAGWG 231
             .|.|||.||||......:.:..|..|.|::|:|.:|| .:.|..|.:.:..|..|:...::|||
  Fly    91 -SSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWG 154

  Fly   232 VTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQAT-ITKYMLCARAAGKDSCSGDSGGPVTRNNT 295
            ....||::....||...:.:|.|.:|.....|..: |...|:||.|:|||:|.||||||:.....
  Fly   155 TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGV 219

  Fly   296 LLGIVSFGYGCARAGYPGVYTAVVAIRQW 324
            |:|:||:|||||.:.|||||..|.|:|.|
  Fly   220 LVGVVSWGYGCAYSNYPGVYADVAALRSW 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 89/218 (41%)
Tryp_SPc 121..324 CDD:238113 80/205 (39%)
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 90/220 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.