DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG34130

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:244 Identity:51/244 - (20%)
Similarity:107/244 - (43%) Gaps:30/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KRVNQNKKAATSSKIQSRIVGGTSTTISTTPYIVQLRRGSN-LCSGSLITEQWVLTAAHCVKGY- 153
            :.:|:|....||        ||     ...|:::::..|.. :|..|.::..:.||:|:|:..: 
  Fly    39 RTLNKNGIRRTS--------GG-----HAVPWLLRIVDGPTFVCGASYLSALYALTSANCMHSHR 90

  Fly   154 ----SASDFTVRGGT---TTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTNIGT 211
                |.|...|...:   ..||..|.....:.:|.|:..:......||.|:::|...|.|.....
  Fly    91 SQMESLSVELVSSDSRQDNQLDSHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLRGNRNNY 155

  Fly   212 ISMGNYRPKAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARA 276
            :::......:...:.:..:|      ...::.::|.:|.|:.:..|...| |...:.:.:.||:.
  Fly   156 VTLCTNPLSSYKSLSVVSYG------AGPAENVRTEEIEVLNRMICDSAY-GNFLLRETVACAKE 213

  Fly   277 AGKDS-CSGDSGGPVTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQW 324
            ..:.: |...:|.|||..:.|.|||::...|.|:..||::|.:..::::
  Fly   214 FKRSADCMFSAGCPVTAGDQLCGIVAWSPACKRSNLPGIFTDIHQVKRF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 47/225 (21%)
Tryp_SPc 121..324 CDD:238113 45/212 (21%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 45/217 (21%)
Tryp_SPc 53..256 CDD:304450 45/209 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.