DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG7829

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:231 Identity:84/231 - (36%)
Similarity:124/231 - (53%) Gaps:7/231 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 SKIQSRIVGGTSTTISTTPYIVQLR-RGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTT 166
            |:...|||||....|:..||||.:: .|.:.|.||:|....:|||.||:.|.......|:.|.|:
  Fly    22 SRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTS 86

  Fly   167 LDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLT-GTNIGTISMGNYRPKAGSRVRIAGW 230
            ....||...||:.:.|...|..|.|:.|..:::|.::|| ...:..|.:...|...|:...||||
  Fly    87 RYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGW 151

  Fly   231 GVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCA--RAAGKDSCSGDSGGPVTRN 293
            |. |..:...|.:|:.|::.:|.|..|| :..|: |:|..||||  ...|.|:|..|||||::..
  Fly   152 GF-KSMNGPPSDSLRYARVPIVNQTACR-NLLGK-TVTDRMLCAGYLKGGTDACQMDSGGPLSVR 213

  Fly   294 NTLLGIVSFGYGCARAGYPGVYTAVVAIRQWATNIM 329
            ..|:||||:|.|||.|..||||:.:.|:..|...::
  Fly   214 EQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 82/219 (37%)
Tryp_SPc 121..324 CDD:238113 76/206 (37%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 82/219 (37%)
Tryp_SPc 28..248 CDD:238113 82/222 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.