DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and intr

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:258 Identity:59/258 - (22%)
Similarity:103/258 - (39%) Gaps:40/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KLSAKRVNQNKKAATS-----SKIQSRIVGGTSTTISTTPYIVQ------LRRGSNLCSGSLITE 140
            |:||:..:...|...|     ::|::.:..|.:||  ..|..|:      |.....:|||:||:.
  Fly    58 KISARFSSGGNKEPNSLEIIPAEIETLLTDGQATT--EAPKAVKHFVMRILYENKVICSGALIST 120

  Fly   141 QWVLTAAHCVKGYSASDFTVRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLT 205
            :.|||:|.|...      |:|.....   |..:..|.|.|:......:..:. |.|||.|:..|.
  Fly   121 RLVLTSALCFPR------TLRQPPPR---SYKLQASRSRIYSVANLITGAIE-DMALLLLHAPLE 175

  Fly   206 GTNIGTISMGNYRPKAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYR--GQATIT 268
            ...:..|.:.....:....|.:          ..:.:.|:..:.:::....|::.|.  ..|.||
  Fly   176 DPFVHPIDLCESPLRRNDNVTM----------YMSQQHLRFLRTKLIPNSNCKRSYAQDENAFIT 230

  Fly   269 KYMLCARAAGK-DSCSGDSGGPVTRNNTLLGIVSFGYGCARAGYPG-VYTAVVAIRQWATNIM 329
            :.||||..:.: ..|....|..:...:.|.|:..:|..|:..|..| :|..|...|   |.:|
  Fly   231 QTMLCALNSNRLVDCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADVFKAR---TELM 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 51/225 (23%)
Tryp_SPc 121..324 CDD:238113 48/212 (23%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 44/191 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.